PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_13032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 192aa    MW: 20124.5 Da    PI: 10.471
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_13032.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.81.2e-4186162278
                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   Cq+e+C adl+eak+yhrrhkvCe+hska+vv+v+gl+qrfCqqCsrfhel efD++krsCrrrLa+hnerrrk++a
  MLOC_13032.1  86 CQAERCGADLTEAKRYHRRHKVCEAHSKAAVVVVAGLRQRFCQQCSRFHELLEFDDQKRSCRRRLAGHNERRRKSSA 162
                   **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-3480147IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.02683160IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.71E-3984163IPR004333Transcription factor, SBP-box
PfamPF031104.4E-3186159IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MDRKDKSRKS PSAASMAALA AAAAAGDVAQ ANGMSGEEDQ KLKLVNVPVV SVGGSSSSAA  60
AVAVRRGSGA AGAVATGAAG AGGPSCQAER CGADLTEAKR YHRRHKVCEA HSKAAVVVVA  120
GLRQRFCQQC SRFHELLEFD DQKRSCRRRL AGHNERRRKS SAEANGGDGC RHADQDGRSH  180
PGNPPLNHFQ IR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-3777159184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560169.31e-77PREDICTED: squamosa promoter-binding-like protein 13
SwissprotQ6Z4612e-52SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLM0UQ371e-135M0UQ37_HORVD; Uncharacterized protein
STRINGMLOC_13032.11e-135(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-40squamosa promoter binding protein-like 4